Web stats for Alternativeremedees - alternativeremedees.com
Overall Health and Spiritual Wellness. Holistic Wellness
4.67 Rating by ClearWebStats
alternativeremedees.com is 3 years 9 months 4 weeks old. This website has a #2,889,407 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, alternativeremedees.com is SAFE to browse.
Traffic Report of Alternativeremedees
Daily Unique Visitors: | 167 |
Daily Pageviews: | 334 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 2,889,407 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is alternativeremedees.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 1 |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 1 |
Google Adsense: | Not Applicable | Google Analytics: | UA-7870337-1 |
Websites Hosted on Same IP (i.e. 142.11.222.188)
HTTP Header Analysis
HTTP/1.1 200 OK
Connection: Keep-Alive
Content-Type: text/html
Last-Modified: Fri, 17 Jul 2020 23:02:34 GMT
Accept-Ranges: bytes
Content-Encoding: br
Vary: Accept-Encoding
Content-Length: 6584
Date: Sun, 19 Jul 2020 19:36:23 GMT
Server: LiteSpeed
Connection: Keep-Alive
Content-Type: text/html
Last-Modified: Fri, 17 Jul 2020 23:02:34 GMT
Accept-Ranges: bytes
Content-Encoding: br
Vary: Accept-Encoding
Content-Length: 6584
Date: Sun, 19 Jul 2020 19:36:23 GMT
Server: LiteSpeed
Domain Information for alternativeremedees.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
alternativeremedees.com | A | 14400 |
IP:142.11.222.188 |
alternativeremedees.com | NS | 86400 |
Target:dalbs78.hostwindsdns.com |
alternativeremedees.com | NS | 86400 |
Target:dalbs77.hostwindsdns.com |
alternativeremedees.com | SOA | 86400 |
MNAME:dalbs77.hostwindsdns.com RNAME:dallasshared.hostwinds.com Serial:2020071402 Refresh:3600 Retry:1800 Expire:1209600 |
alternativeremedees.com | MX | 14400 |
Target:alternativeremedees.com |
alternativeremedees.com | TXT | 14400 |
TXT:v=spf1 +a +mx +ip4:142.11.222.160 +ip4:142.11.222.188 ~all |
Similarly Ranked Websites to Alternativeremedees
Cleveland Furniture Store - Sedlak Interiors
- sedlakinteriors.com
Sedlak Interiors Cleveland Furniture Store servicing Solon, Cleveland, Canton, Medina, Akron, Youngstown, Ohio furniture stores has a great selection of living room, bedroom, dining room, home office, entertainment, accent tables, mattresses and more.
PDF Software | thefreepdfreader.com
- thefreepdfreader.com
Download PDF Software free from thefreepdfreader. Safe, recommended, editor-reviewed software files for your PC computer.
99 Jeevesway Digital Marketing Services – Digital Marketing Services | Local Business
- 99jeeveswaydigitalmarketingservices.com
Plastic Surgery Utah - The Best Cosmetic Surgeon In Salt Lake City
- surface-med.com
Utah plastic Surgeons Dr. Barson and staff provide Utah with plastic surgery options for residents throughout Utah & Salt Lake City. Discover the best
Full WHOIS Lookup for alternativeremedees.com
Domain Name: ALTERNATIVEREMEDEES.COM
Registry Domain ID: 2546101493_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2020-07-14T20:06:02Z
Creation Date: 2020-07-14T20:06:02Z
Registry Expiry Date: 2021-07-14T20:06:02Z
Registrar: eNom, LLC
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DALBS77.HOSTWINDSDNS.COM
Name Server: DALBS78.HOSTWINDSDNS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-07-19T19:36:12Z
Registry Domain ID: 2546101493_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2020-07-14T20:06:02Z
Creation Date: 2020-07-14T20:06:02Z
Registry Expiry Date: 2021-07-14T20:06:02Z
Registrar: eNom, LLC
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DALBS77.HOSTWINDSDNS.COM
Name Server: DALBS78.HOSTWINDSDNS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-07-19T19:36:12Z