Overall Health and Spiritual Wellness. Holistic Wellness

4.67 Rating by ClearWebStats
alternativeremedees.com is 3 years 9 months 4 weeks old. This website has a #2,889,407 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, alternativeremedees.com is SAFE to browse.
Get Custom Widget

Traffic Report of Alternativeremedees

Daily Unique Visitors: 167
Daily Pageviews: 334

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 2,889,407
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View alternativeremedees.com site advisor rating Not Applicable

Where is alternativeremedees.com server located?

Hosted IP Address:

142.11.222.188 View other site hosted with alternativeremedees.com

Hosted Country:

alternativeremedees.com hosted country US alternativeremedees.com hosted country

Location Latitude:

47.4902

Location Longitude:

-122.3004

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View alternativeremedees.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: UA-7870337-1

Websites Hosted on Same IP (i.e. 142.11.222.188)

Index of /

alternativeremedees.com favicon - homechikenstore.com

View alternativeremedees.com Pagerank   alternativeremedees.com alexa rank Not Applicable   alternativeremedees.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Connection: Keep-Alive
Content-Type: text/html
Last-Modified: Fri, 17 Jul 2020 23:02:34 GMT
Accept-Ranges: bytes
Content-Encoding: br
Vary: Accept-Encoding
Content-Length: 6584
Date: Sun, 19 Jul 2020 19:36:23 GMT
Server: LiteSpeed

Domain Information for alternativeremedees.com

Domain Registrar: eNom, LLC alternativeremedees.com registrar info
Registration Date: 2020-07-14 3 years 9 months 4 weeks ago
Last Modified: 2020-07-14 3 years 9 months 4 weeks ago

Domain Nameserver Information

Host IP Address Country
dalbs77.hostwindsdns.com alternativeremedees.com name server information 142.11.222.160 alternativeremedees.com server is located in United States United States
dalbs78.hostwindsdns.com alternativeremedees.com name server information 142.11.222.161 alternativeremedees.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
alternativeremedees.com A 14400 IP:142.11.222.188
alternativeremedees.com NS 86400 Target:dalbs78.hostwindsdns.com
alternativeremedees.com NS 86400 Target:dalbs77.hostwindsdns.com
alternativeremedees.com SOA 86400 MNAME:dalbs77.hostwindsdns.com
RNAME:dallasshared.hostwinds.com
Serial:2020071402
Refresh:3600
Retry:1800
Expire:1209600
alternativeremedees.com MX 14400 Target:alternativeremedees.com
alternativeremedees.com TXT 14400 TXT:v=spf1 +a +mx +ip4:142.11.222.160
+ip4:142.11.222.188 ~all

Similarly Ranked Websites to Alternativeremedees

Cleveland Furniture Store - Sedlak Interiors

alternativeremedees.com favicon - sedlakinteriors.com

Sedlak Interiors Cleveland Furniture Store servicing Solon, Cleveland, Canton, Medina, Akron, Youngstown, Ohio furniture stores has a great selection of living room, bedroom, dining room, home office, entertainment, accent tables, mattresses and more.

View alternativeremedees.com Pagerank   Alexa rank for alternativeremedees.com 2,889,415   website value of alternativeremedees.com $ 240.00

PDF Software | thefreepdfreader.com

alternativeremedees.com favicon - thefreepdfreader.com

Download PDF Software free from thefreepdfreader. Safe, recommended, editor-reviewed software files for your PC computer.

View alternativeremedees.com Pagerank   Alexa rank for alternativeremedees.com 2,889,420   website value of alternativeremedees.com $ 240.00

99 Jeevesway Digital Marketing Services – Digital Marketing Services | Local Business

alternativeremedees.com favicon - 99jeeveswaydigitalmarketingservices.com

View alternativeremedees.com Pagerank   Alexa rank for alternativeremedees.com 2,889,426   website value of alternativeremedees.com $ 240.00

Page Not Found - ClearWebStats.com

alternativeremedees.com favicon - belinuxmyfriend.com

View alternativeremedees.com Pagerank   Alexa rank for alternativeremedees.com 2,889,432   website value of alternativeremedees.com $ 240.00

Plastic Surgery Utah - The Best Cosmetic Surgeon In Salt Lake City

alternativeremedees.com favicon - surface-med.com

Utah plastic Surgeons Dr. Barson and staff provide Utah with plastic surgery options for residents throughout Utah & Salt Lake City. Discover the best

View alternativeremedees.com Pagerank   Alexa rank for alternativeremedees.com 2,889,432   website value of alternativeremedees.com $ 240.00

Full WHOIS Lookup for alternativeremedees.com

Domain Name: ALTERNATIVEREMEDEES.COM
Registry Domain ID: 2546101493_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2020-07-14T20:06:02Z
Creation Date: 2020-07-14T20:06:02Z
Registry Expiry Date: 2021-07-14T20:06:02Z
Registrar: eNom, LLC
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DALBS77.HOSTWINDSDNS.COM
Name Server: DALBS78.HOSTWINDSDNS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-07-19T19:36:12Z